نشان ویژگی ملکولی ژن گاما توکوفرول متیل ترانسفراز (γ-tmt) از گیاه گوجه فرنگی (Lycopersicum esculentum L.) رقم Memory 1

نوع مقاله: علمی - پژوهشی

چکیده

هدف: هدف این تحقیق همسانه سازی ژن گاما توکوفرول متیل ترانسفراز (γ-tmt) از گیاه گوجه فرنگی رقم Memory 1، جهت تعیین توالی و خصوصیات ملکولی آن و نیز انتقال این ژن به یک گیاه روغنی مثل کلزا در پژوهش‏های آتی برای بالا بردن خاصیت تغذیه ای آن بود. مواد و روش ها: از بافت میوه گوجه فرنگی، RNAی کل استخراج و ساخت  cDNAصورت گرفت. با استفاده از آغازگرهای اختصاصی ژن مذکور تکثیر و همراه با ناقلpBluescript (SK-) به کمک آنزیم برشی XbaI هضم و واکنش اتصال با آنزیم T4 انجام شد. باکتریE. coli مستعد با ناقل نوترکیب تراریخت و شناسایی کلونی‏های نوترکیب بر اساس آزمون سفید–آبی انجام شد. نتایج: با استفاده از PCR و آغازگرهای اختصاصی، cDNA به طول 1089 bp به دست آمد. همردیف سازی توالی نوکلئوتیدی و اسیدآمینه ای ژن هدف با توالی های γ-tmt دیگر ثبت شده از خانواده Solanaceae به میزان 98 درصد شباهت داشت. در توالی اسید آمینه ای پروتئین استنتاج شده چند تغییر مشاهده شد. با استفاده از نرم افزار PSIpred، ساختارهای دوم و سوم این پروتئین پیش بینی و با استفاده از نرم افزار ClustalW درخت فیلوژنتیکی پروتئین حاصل از این ژن ساخته شد.  نتیجه گیری: cDNAی ژن γ-tmt همسانه سازی شده با توالی  ثبت شده از گوجه فرنگی رقم Cerasiforme 98 درصد شباهت داشت. با انتقال این ژن به گیاهان دانه روغنی مانند کلزا می توان میزان آلفا توکوفرول را افزایش داد. این کار هم به اهمیت این گیاه از نظر تغذیه‏ای می افزاید و هم می تواند مقاومت آن را نسبت به تنش های محیطی بالا ببرد.

کلیدواژه‌ها


مقدمه

ویتامین E یکی از ویتامین‏های محلول در چربی و ضروری برای انسان است که بیشتر به دلیل خاصیت آنتی اکسیدانتی‏اش در بدن شناخته شده است. از میان هشت شکل طبیعی این ویتامین، آلفا توکوفرول دارای بالاترین فعالیت و به دلیل جذب انتخابی آن توسط پروتئین جگری ناقل آلفا توکوفرول بیشتر در دسترس است (1و2). در بدن انسان این ویتامین دارای دو عملکرد است بدین معنا که هم به عنوان یک ویتامین عمل می‏نماید و هم نقش یک آنتی اکسیدانت مهم را ایفا می‏کند (3). زمانی نقش بسیار مهم آلفا توکوفرول به عنوان یک آنتی اکسیدانت بیشتر آشکار می‏شود که رابطه ی بسیاری از بیماری‏ها با خاصیت مذکور روشن می شود. از آنجا که معمولا نشانه‏های بیماری پس از سال ها تجمع رادیکال های آزاد در بدن ظاهر می‏شوند لذا بیماری‏های ایجاد شده توسط این رادیکال اکثرا دارای دوره‏ی نهفتگی بلند مدت می‏باشند. برخی از اثرات این ویتامین بر این بیماری ها عبارتند از: کاهش احتمال بیماری‏های قلبی- عروقی، موثر در درمان انواع سرطان، کند شدن پدیده پیری سلول‏ها و بافت‏ها، حفظ سلامت سلول‏های قرمز خون و مقابله با کم خونی، تسریع در بهبود زخم ها، کمک به درمان اختلالات تولیدمثلی، بهبود عملکرد سیستم ایمنی، کند شدن پیشرفت بیماری‏هایی که با پدیده‏ی پیری همراه اند (مانند آب مروارید و آرتریتیس) (4، 5و6).

ویتامین E تنها در موجودات فتوسنتز کننده و برخی از سیانوباکتری ها تولید می شود، بنابراین منبع تامین آن در انسان مصرف گیاهان است (7). بیشترین غلظت توکوفرول را می توان در دانه های روغنی گیاهانی همچون کانولا، نخل، گلرنگ، سویا و آفتابگردان یافت که غلظت توکوفرول طبیعی در دانه ی آن ها بطور میانگین 10 تا 20 برابر بیشتر از بافت هایی غیر از دانه است. این درحالی است که بیشترین ایزوفرم موجود در آنها گاما توکوفرول یعنی همان پیش ماده ی بیوسنتزی آلفا توکوفرول می باشد (8). توانایی آنزیم گاما توکوفرول متیل ترانسفراز در جابجایی گروه متیل در سال 1980 شناسایی و محل آن در غشای داخلی کلروپلاست اسفناج تعیین (9و10) و پس از آن در سال 1985 توسط دارلینگ و کامارا از کروموپلاست فلفل استخراج گردید (11).

ژن توکوفرول متیل ترانسفراز از باکتری سینکوسیستیس از طریق یافتن همولوژی با دیگر ژن های شناسایی شده در مسیر بیوسنتز ویتامین E شناسایی شد. این ژن در اربیدوپسیس از طریق جستجوی همولوژی با ژن γ-tmt باکتری سینکوسیستیس در سال 1998 شناسایی شد. همچنین این نکته روشن گردید که گونه های مختلف گیاهان روغنی دارای مقدار زیادی توکوفرول در دانه‏های خود هستند. اما در اکثر گیاهان دانه روغنی همچون دانه‏های سویا و کلزا، میزان گاما توکوفرول (پیش ماده‏ی آلفا- توکوفرول)، نسبت به آلفا-توکوفرول بسیار بیشتر است (8). بنابراین تبدیل متابولیکی گاما توکوفرول به آلفا توکوفرول از طریق فناوری گیاهان تراریخت جهت افزایش کارآیی جذب آن توسط انسان و جانوران مد نظر بوده است. این کار برای اولین بار با ابر بیان ژن γ-tmt در گیاه مدل اربیدوپسیس صورت گرفت (8). بدین وسیله به نقش کلیدی آنزیم γ -TMT در تعیین نوع توکوفرول موجود در دانه پی برده شد . محققین طی این آزمایش ژن کد کننده ی آنزیم گاما توکوفرول متیل ترانسفراز را از گیاه thaliana Arabidopsis همسانه سازی و سپس cDNA آن را تعیین توالی کردند. در این مطالعه محققین با ابر بیان ژن مذکور، ترکیب دانه‏های           A. thaliana را از 97 درصد گاما توکوفرول به 95 درصد آلفا توکوفرول تبدیل کردند (8).

فعالیت‏های زیستی بسیاری از جمله از بین بردن ملکول‏های اکسیژن یگانه که در طی واکنش های فتوسیستم II ایجاد می‏شوند (12)، کنترل غیر آنزیمی اکسایش لیپید ها در گیاهان (13) و افزایش سازگاری گیاهان به دماهای پایین (14)، به توکوفرول‏ها نسبت داده شده است. در جهت افزایش میزان آلفا توکوفرول در گیاهان مختلف پژوهش‏هایی انجام شده که اجمالا به برخی از آن‏ها اشاره می گردد.

در سال 2005، محتوی آلفا توکوفرول برگ گیاه کاهو با ابر بیان ژن γ -tmt گیاه اربیدوپسیس تا سه برابر افزایش یافت. در این آزمایش نقشγ -TMT در کنترل میزان تولید آلفا توکوفرول در برگ کاهو و همبستگی میان mRNA تراریخت و میزان فعالیت ژن به اثبات رسید )15(. در سال 2006 با بیان ژن γ -tmt گیاه اربیدوپسیس در گیاه دانه روغنی Brassica juncea میزان آلفا توکوفرول دانه های این گیاه شش برابر گردید )16(. در سال 2007 (17) و سپس در سال 2011 (18) با همسانه سازی و سپس ابر بیان ژن γ -tmt Perilla frutescens در خود گیاه بیشتر گاما توکوفرول موجود در دانه به آلفاتوکوفرول تبدیل گردید. در سال 2007 نیز محققان با ابر بیان ژن گاما توکوفرول متیل ترانسفراز گیاه Perilla frutescens در گیاه سویا مقدار آلفا توکوفرول دانه را چندین برابر افزایش دادند (19). با توجه به اینکه آلفا توکوفرول در میان تمامی ایزوفرم های دیگر این ویتامین دارای بالاترین فعالیت بیولوژیکی، و آنزیم گاما توکوفرول متیل ترانسفراز آخرین آنزیم در مسیر بیوسنتز آلفا توکوفرول است در نتیجه افزایش تولید ویتامینE ، هدف مهندسی گیاهان تراریخت، ترجیحا ابر بیان آنزیم گاما توکوفرول متیل ترانسفراز می باشد. این پژوهش با هدف استخراج و همسانه سازی ژن گاما متیل ترنسفراز از گیاه گوجه فرنگی رقم Memory 1 انجام شد تا بتوان در قدم بعدی این ژن را جهت بالا بردن ارزش تغذیه ای، به یک گیاه دانه روغنی مانند کلزا منتقل نمود. توالی این ژن در گیاه گوجه فرنگی در ارقام دیگری قبلا به ثبت رسیده است؛ اما در رقم  Memory 1تا پیش از این مطالعه،  شناسایی نشده و به ثبت نرسیده بود.

 

مواد و روش‌ها

استخراج RNA: تمامی وسایل پلاستیکی و شیشه ای و همچنین محلول های مورد نیاز به استثنای محلول های حاوی Tris با استفاده از محلول DEPC (دی اتیل پیروکربنات) یک دهم درصد ضد عفونی و عاری از آنزیم های RNase شدند. سپس وسایل و محلول ها به مدت 12 ساعت در 37 درجه سانتی گراد گرمخانه گذاری (incubation) و به مدت 15 دقیقه اتوکلاو شدند تا DEPC از طریق شکسته شدن به دی اکسیدکربن، آب و اتانول کاملا  از بین برود. بافر استخراج شامل

 [Tris-HCl 300mM, EDTA 25mM, NaCl 2M, CTAB 2% (w/v), PVP 2% (w/v), ß-Mercaptoethanol 2%, DEPC-treated water 0.1%]

به میزان 27 میلی‏لیتر برای هر 5/2 گرم از نمونه ی پودر شده تهیه گردید. همه‏ی مواد بجز بتا- مرکاپتواتانول درون فالکون 50 میلی لیتری ریخته و در حمام آب گرم در دمای 80 درجه ی سانتی گراد به مدت 30 الی 45 دقیقه قرار داده شدند. استخراج RNA بر اساس روش تغییر یافته رید وهمکاران (20) صورت گرفت.

واکنش نسخه برداری معکوس تهیه cDNA: جهت سنتز cDNA واکنش نسخه برداری معکوس به روش زیر انجام گرفت. مخلوط زیر در یک میکروتیوب استریل روی یخ تهیه گردید.

Template (total RNA or mRNA):  50 ng

Primer (Oligo (dT)18):  1 pmol

Deionized and nuclease-free water to final volume: 7-12 µl

مخلوط حاصل به مدت 5 دقیقه در 70 درجه سانتی‏گراد و سپس روی یخ قرار داده شد و مواد زیر به آن اضافه شد:

5 X reaction buffer: 4 µl

dNTP Mix 10 mM:  2 µl

مخلوط حاصل به مدت 5 دقیقه در دمای 37 درجه سانتی‏گراد قرار داده شد و سپس مقدار 1 میکرولیتر از آنزیم نسخه برداری معکوس (reverse transcriptase، سیناژن، ایران) به ترکیب فوق اضافه و مخلوط فوق به مدت 60 دقیقه دردمای 42 درجه سانتی‏گراد قرار داده شد. واکنش فوق با قرار دادن مخلوط واکنش در 70 درجه سانتی‏گراد به مدت 10 دقیقه متوقف گردید.

تکثیر cDNA ژن tmt با استفاده از PCR: آغازگر های اختصاصی با توجه به توالی ژن tmt گیاه گوجه فرنگی با شماره دستیابی DQ456876 طراحی و برای تکثیر cDNAی ژن tmt به طول bp1089 سنتز شدند (جایگاه برش آنزیمی  XbaIدر دو انتهای ¢ 5 دو آغازگر اختصاصی tmtF و tmtR طراحی شد).

5' TATCTAGAATGGGCAGCCAATGCTATT 3'

5' GCTCTAGATTATTCAGGTTTTCGACATGTG 3'

واکنش PCR پس از بهینه سازی دمای اتصال جهت تکثیر اختصاصی و تک باند شدن محصول PCR در دمای 60 درجه سانتی‏گراد با استفاده از PCR Master Mix (سیناژن، ایران) صورت گرفت. سپس واکنش برای 30 دور، شامل دمای 94 درجه سانتی‏گراد به مدت 45 ثانیه، دمای 60 درجه سانتی‏گراد به مدت 1 دقیقه و در نهایت، دمای 72 درجه سانتی گراد به مدت یک دقیقه انجام گردید. بعد از اتمام 30 دور واکنش، تیوب ها به مدت ده دقیقه در 72 درجه سانتی گراد قرار گرفتند. محصول PCR روی ژل آگارز یک درصد الکتروفورز گردید.

cDNAی مورد نظر پس از خالص سازی از ژل به کمک   DNA Extraction Kit (شرکت فرمنتاس) و برش توسط آنزیم XbaI با استفاده از آنزیم T4 DNA Ligase به ناقل از پیش برش یافته اتصال یافت. پس از مستعد سازی سلول‏های E. coli، باکتری های مستعد با استفاده از ناقل های نوترکیب تراریخت شدند. آزمایش های تاییدی جهت اطمینان از نوترکیبی کلنی ها به ترتیب زیر صورت گرفت: آزمون کلنی‏های سفید- آبی، Toothpick minipreparation، استخراج فاژمید و هضم آنزیمی توسط آنزیم XbaI (21).

پس از انجام آزمایش‏های تاییدی جهت اطمینان از حضور cDNAی ژن tmt در فاژمید نوترکیب و مطالعه توالی ژن همسانه سازی شده از توالی یابی استفاده شد. به این منظور ناقل نوترکیب از باکتریE. coli  تراریخت شده استخراج و به همراه آغازگرهای اختصاصی رفت و برگشت جهت توالی یابی در دو جهت به شرکت Millgen فرانسه ارسال شد.

مقایسه توالی پروتئینی استنتاج شده از ژن tmt با دیگر پروتئین های مشابه: پس از تعیین توالی نوکلئوتیدیcDNA  ژن γ-tmt همسانه سازی شده، توالی اسید آمینه‏ای آن با استفاده از سایت http://expasy.org/translate مشخص و سپس درخت فیلوژنتیک با استفاده از نرم افزار آنلاین ClustalW (http://www.ebi.ac.uk/Tools/msa/clustalw)  رسم گردید. جهت این کار توالی پروتیین‏های مشابه با شماره‏های دستیابی

(ZP-08985217) Fisherella sp.,

(AE68180) Perilla frutescens,

(ADZ24710) Solanum penellii,

(BAK57287) Glycine max,

(NP_176677) Arabidopsis thaliana,

(BAJ86294) Hordeum vulgare,

(ZP_07111019) Oscillatoria sp.,

(YP_003722211) Nostoc azolae,

(EGB05977) Aureococcus anaphagefferens,

(NP_091105914) Zea mays,

(EAZ24304) Synechococcus sp.,

(ADV36922) Solanum tuberosum,

(CBN74411) Ectocarpus siliculosus,

(ZP_00518612) Crocosphaera watsonii,

(ADC91915) Lactuca sativa,

(ADP00411) Catharanthus roseus,

(ZP_05030254) Microcoleus chthonoplastes,

(YP_001657502) Microcystis aeroginosa,

(XP_003083842) Ostrecoccus tauri,

(XP_002951641) Volvox carteri,

(XP_001421685) Ostrococcus lucimarinus, (XP_00288296) Arabidipsis lyrata,

(XP_002319777) Populus tricocaroa,

(XP_001694470) Clamydomonas reinhardtii,

(XP_002292406) Thalacsiosira pseudomona, (XP_002180606) Phaeodactylum tricornutum, (AA013806) Brassica oleracea,

(ABB52800) Helianthus annuus,

(ACD03285) Brassica napus,

(XP_002503087) Micromonas sp.,

(XP_002454429)  Sorghum bicolor,

(AC057634) Linum sitatissimum,

(XP_002269749) Vitis vinifera,

(BAH10645) Hevea brasiliensis,

(ACj84366) Medicago truncaula,

(CAI77219) Triticum aestivum,

(ABI23433) Brassica juncea.

مورد استفاده قرار گرفتند.

خصوصیات بیوشیمیایی پروتئین ژن همسانه سازی شده در سایت ProtParam http://web.expasy.org/protparam)) بررسی گردید. ساختار دوم و سوم پروتئین نیز                  توسط نرم افزار آنلاین سایت PSIpred (http://bioinf.cs.ucl.ac.uk/psipred) پیش بینی و رسم گردید. بررسی موقعیت زیر سلولی پروتئین مذکور                با استفاده از نرم افزارهای TargetP (http://www.cbs.dtu.dk/services/TargetP) و Psort (http://www.psort.org) و وجود پپتید پیام              (signal peptide) توسط نرم افزار iPsort (http://ipsort.hgc.jp) انجام شد.

 

 

نتایج

در این تحقیق cDNAی ژن  γ-tmtاز گیاه گوجه فرنگی رقم Memory1 به طول bp 1089 جهت بررسی توالی و استفاده برای انتقال به یک گیاه دانه روغنی مانند کلزا، در پژوهش های آتی، تکثیر گردید. بدین منظور از مرحله‏ی قرمز این گیاه، RNA استخراج و واکنش RT-PCR انجام گردید. پس از الکتروفورز محصول PCR روی ژل اگارز یک درصد، یک باند بطول حدود Kb 1/1 مشاهده گردید (شکل A1). 

باند مذکور از ژل آگارز استخراج و خالص سازی گردید. با توجه به صحت طول قطعه، واکنش اتصال قطعه‏ی مذبور و ناقل pBluescript صورت گرفت. باکتری‏های مستعد شده E. coli توسط فاژمیدهای نوترکیب تراریخته شدند. کلنی های تراریخت شده‏ی نوترکیب ابتدا از طریق آزمون کلنی‏های سفید- آبی غربال گردیدند (شکلB 1). سپس جهت بررسی بیشتر، آزمون Tooth pick minipreparation نیز روی کلنی‏های سفید صورت گرفت و کلنی‏های نوترکیب از روی اختلاف اندازه شان انتخاب گردیدند (شکل A2). پس از انتخاب کلنی‏های نوترکیب، ناقل آنها استخراج گردید. با استفاده از آنزیم XbaI آزمایش هضم آنزیمی صورت گرفت که به ترتیب قطعات مورد انتظار با طول  bp1089 و bp 2961 حاصل و بدین ترتیب همسانه‏سازی ژن گاما- توکوفرول متیل ترانسفراز تایید گردید (شکل B2).

 

 

 

شکل 1: A- تکثیر cDNAی tmt-γ در دمای اتصال 60 درجه سانتی گراد توسط PCR. ردیف1 نشانگر اندازه ملکولی kb 1 (سینا ژن، ایران) .            B- تشخیص کلنی‏های نو ترکیب توسط آزمون کلنی‏های سفید- آبی. کلنی‏های آبی فاقد پلازمید نوترکیب و کلنی‏های سفید حاوی پلازمید نو ترکیب‏اند.

 

 

 

شکل2: A) آزمون .toothpick minipreparation فاژمید هایی که بالاتر قرارگرفته اند (نشان داده شده با پیکان، ردیف های 5، 6، 9، 10، 11، 12)، نوترکیب هستند. B) فاژمید نوترکیب هضم شده توسط آنزیم XbaI: مطابق انتظار ژن مورد نظر، به ترتیب از پایین به بالا، با طول bp 1089 و فاژمید با طول bp 2961 حاصل شد. M نشانگر اندازه ملکولی kb 1 (سینا ژن، ایران).

 

 

 

بررسی ویژگی توالی اسیدهای آمینه و خصوصیات بیوشیمیایی پروتئین استنتاج شده از ژن هدف با استفاده از ابزار ProtParam نشان داد که ژن هدف، پروتئینی با طول 362 اسید آمینه و وزن مولکولی 5/39800 دالتون و pH ایزوالکتریک 28/8 را کد می‏کند. فرمول شیمیایی این پروتئینC1764H2785N483O529S18  و در مجموع دارای 5579 اتم است. بیشترین و کمترین اسید آمینه را در توالی این پروتئین به ترتیب سرین (42 عدد) با 2/11  درصد و هیستیدین (7 عدد) با 9/1 درصد به خود اختصاص می‏دهند. این        آنزیم دارای 41 اسید آمینه بازی، 38 اسید آمینه اسیدی، 127 اسید آمینه آبگریز و 99 اسید آمینه قطبی است. با استفاده از نرم افزار آنلاین iPsort مشخص گردید که پروتئین           مذکور دارای پپتید پیام با توالی MGSQCYSAYSIQSLNPTCPSSSSSSVIFSL برای انتقال به کلروپلاست است و نرم افزارهای آنلاین TargetP و Psort احتمال کلروپلاستی بودن این پروتئین را به ترتیب 97 و 100 درصد پیش بینی کردند. همردیف سازی توالی نوکلئوتیدی (شکل 3) و اسید آمینه‏ای توالی (شکل 4) به دست آمده با دیگر توالی‏های ثبت شده از گیاه گوجه فرنگی در بانک NCBI انجام شد. تفاوت‏هایی در نوکلئوتیدهای شماره 84، 273، 561 و 642 مشاهده شد. این تغییرات باعث جایگزینی دو اسید آمینه گردید (بحث را مشاهده کنید).

 

 

JN620365        -----------------ATGGGCAGCCAATGCTATTCCGCTTATTCTATCCAATCATTGA 43

GU358684        ------------TAGTAATGGGCAGCCAATGCTATTCCGCTTATTCTATCCAATCATTGA 48

GU563800        ------------TAGTAATGGGCAGCCAATGCTATTCCGCTTATTCTATCCAATCATTGA 48

DQ456876        ATATATATAGTATAGTAATGGGCAGCCAATGCTATTCCGCTTATTCTATCCAATCATTGA 60

ABE41794        -----------------ATGGGCAGCCAATGCTATTCCGCTTATTCTATCCAATCATTGA 43

                                 *******************************************

 

JN620365        ACCCCACGTGTCCATCATCTTCTTCCTCCTCTGTTATCTTCTCTCTTCTTAAACCCCAGA 103

GU358684        ACCCCACGTGTCCATCATCTTCTTCCTCCTCTGTTATCTTCACTCTTCTTAAACCCCAGA 108

GU563800        ACCCCACGTGTCCATCATCTTCTTCCTCCTCTGTTATCTTCACTCTTCTTAAACCCCAGA 108

DQ456876        ACCCCACGTGTCCATCATCTTCTTCCTCCTCTGTTATCTTCACTCTTCTTAAACCCCAGA 120

ABE41794        ACCCCACGTGTCCATCATCTTCTTCCTCCTCTGTTATCTTCACTCTTCTTAAACCCCAGA 103

                *****************************************:******************

 

JN620365        TTCACAGAAGAAGAATCATTACTTGTTGTAATAGTAGTAGAAGAAGAAGAAGAATGGCTA 163

GU358684        TTCACAGAAGAAGAATCATTACTTGTTGTAATAGTAGTAGAAGAAGAAGAAGAATGGCTA 168

GU563800        TTCACAGAAGAAGAATCATTACTTGTTGTAATAGTAGTAGAAGAAGAAGAAGAATGGCTA 168

DQ456876        TTCACAGAAGAAGAATCATTACTTGTTGTAATAGTAGTAGAAGAAGAAGAAGAATGGCTA 180

ABE41794        TTCACAGAAGAAGAATCATTACTTGTTGTAATAGTAGTAGAAGAAGAAGAAGAATGGCTA 163

                ************************************************************

 

JN620365        GTGTTGCTGCGATGAATGCTGTGTCTTCGTCATCTGTAGAAGTTGGAATACAGAATCAAC 223

GU358684        GTGTTGCTGCGATGAATGCTGTGTCTTCGTCATCTGTAGAAGTTGGAATACAGAATCAAC 228

GU563800        GTGTTGCTGCGATGAATGCTGTGTCTTCGTCATCTGTAGAAGTTGGAATACAGAATCAAC 228

DQ456876        GTGTTGCTGCGATGAATGCTGTGTCTTCGTCATCTGTAGAAGTTGGAATACAGAATCAAC 240

ABE41794        GTGTTGCTGCGATGAATGCTGTGTCTTCGTCATCTGTAGAAGTTGGAATACAGAATCAAC 223

                ************************************************************

 

JN620365        AGGAGCTGAAAAAAGGAATTGCAGATTTATATGATGAGTCTTCTGGGATTCGGGAAGATA 283

GU358684        AGGAGCTGAAAAAAGGAATTGCAGATTTATATGATGAGTCTTCTGGGATTCGGGAAGATA 288

GU563800        AGGAGCTGAAAAAAGGAATTGCAGATTTATATGATGAGTCTTCTGGGATTCGGGAAGATA 288

DQ456876        AGGAGCTGAAAAAAGGAATTGCAGATTTATATGATGAGTCTTCTGGGATTTGGGAAGATA 300

ABE41794        AGGAGCTGAAAAAAGGAATTGCAGATTTATATGATGAGTCTTCTGGGATTTGGGAAGATA 283

                ************************************************** *********

 

JN620365        TTTGGGGTGACCATATGCATCATGGATATTATGAACCTAAATCCTCTGTGGAACTTTCAG 343

GU358684        TTTGGGGTGACCATATGCATCATGGATATTATGAACCTAAATCCTCTGTGGAACTTTCAG 348

GU563800        TTTGGGGTGACCATATGCATCATGGATATTATGAACCTAAATCCTCTGTGGAACTTTCAG 348

DQ456876        TTTGGGGTGACCATATGCATCATGGATATTATGAACCTAAATCCTCTGTGGAACTTTCAG 360

ABE41794        TTTGGGGTGACCATATGCATCATGGATATTATGAACCTAAATCCTCTGTGGAACTTTCAG 343

                ************************************************************

 

JN620365        ATCATCGTGCTGCTCAGATCCGTATGATTGAACAGGCTCTAAGTTTTGCTGCTATTTCTG 403

GU358684        ATCATCGTGCTGCTCAGATCCGTATGATTGAACAGGCTCTAAGTTTTGCTGCTATTTCTG 408

GU563800        ATCATCGTGCTGCTCAGATCCGTATGATTGAACAGGCTCTAAGTTTTGCTGCTATTTCTG 408

DQ456876        ATCATCGTGCTGCTCAGATCCGTATGATTGAACAGGCTCTAAGTTTTGCTGCTATTTCTG 420

ABE41794        ATCATCGTGCTGCTCAGATCCGTATGATTGAACAGGCTCTAAGTTTTGCTGCTATTTCTG 403

                ************************************************************

 

JN620365        AAGATCCAGCGAAGAAACCAACGTCCATAGTTGATGTTGGATGTGGCATCGGTGGCAGTT 463

GU358684        AAGATCCAGCGAAGAAACCAACGTCCATAGTTGATGTTGGATGTGGCATCGGTGGCAGTT 468

GU563800        AAGATCCAGCGAAGAAACCAACGTCCATAGTTGATGTTGGATGTGGCATCGGTGGCAGTT 468

DQ456876        AAGATCCAGCGAAGAAACCAACGTCCATAGTTGATGTTGGATGTGGCATCGGTGGCAGTT 480

ABE41794        AAGATCCAGCGAAGAAACCAACGTCCATAGTTGATGTTGGATGTGGCATCGGTGGCAGTT 463

                ************************************************************

 

JN620365        CTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCACTTTGAGTCCTGTAC 523

GU358684        CTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCACTTTGAGTCCTGTAC 528

GU563800        CTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCACTTTGAGTCCTGTAC 528

DQ456876        CTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCACTTTGAGTCCTGTAC 540

ABE41794        CTAGGTACCTTGCAAAGAAATATGGCGCTACAGCTAAAGGTATCACTTTGAGTCCTGTAC 523

                ************************************************************

JN620365        AAGCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGGTTAGGTGATAAGGTTTCATTTC 583

GU358684        AAGCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGATTAGGTGATAAGGTTTCATTTC 588

GU563800        AAGCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGATTAGGTGATAAGGTTTCATTTC 588

DQ456876        AAGCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGATTAGGTGATAAGGTTTCATTTC 600

ABE41794        AAGCAGAGAGGGCTCAAGCTCTTGCTGATGCTCAGGGATTAGGTGATAAGGTTTCATTTC 583

                *************************************.**********************

 

JN620365        AAGTAGCAGACGCCTTGAATCAGCCTTTTCCAGATGGGCAATTCGACTTGGTTTGGTCGA 643

GU358684        AAGTAGCAGACGCCTTGAATCAGCCTTTTCCAGATGGGCAATTCGACTTGGTTTGGTCCA 648

GU563800        AAGTAGCAGACGCCTTGAATCAGCCTTTTCCAGATGGGCAATTCGACTTGGTTTGGTCCA 648

DQ456876        AAGTAGCAGACGCCTTGAATCAGCCTTTTCCAGATGGGCAATTCGACTTGGTTTGGTCCA 660

ABE41794        AAGTAGCAGACGCCTTGAATCAGCCTTTTCCAGATGGGCAATTCGACTTGGTTTGGTCCA 643

                ********************************************************** *

 

JN620365        TGGAGAGTGGAGAACACATGCCGAACAAAGAAAAGTTTGTTGGCGAATTAGCTCGAGTGG 703

GU358684        TGGAGAGTGGAGAACACATGCCGAACAAAGAAAAGTTTGTTGGCGAATTAGCTCGAGTGG 708

GU563800        TGGAGAGTGGAGAACACATGCCGAACAAAGAAAAGTTTGTTGGCGAATTAGCTCGAGTGG 708

DQ456876        TGGAGAGTGGAGAACACATGCCGAACAAAGAAAAGTTTGTTGGCGAATTAGCTCGAGTGG 720

ABE41794        TGGAGAGTGGAGAACACATGCCGAACAAAGAAAAGTTTGTTGGCGAATTAGCTCGAGTGG 703

                ************************************************************

 

JN620365        CAGCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCGG 763

GU358684        CAGCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCGG 768

GU563800        CAGCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCGG 768

DQ456876        CAGCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCGG 780

ABE41794        CAGCACCAGGAGGCACAATCATCCTTGTCACATGGTGCCACAGGGACCTTTCCCCTTCGG 763

                ************************************************************

 

JN620365        AGGAATCTCTGACTCCAGAGGAGAAAGAGCTGTTAAATAAGATATGCAAAGCCTTCTATC 823

GU358684        AGGAATCTCTGACTCCAGAGGAGAAAGAGCTGTTAAATAAGATATGCAAAGCCTTCTATC 828

GU563800        AGGAATCTCTGACTCCAGAGGAGAAAGAGCTGTTAAATAAGATATGCAAAGCCTTCTATC 828

DQ456876        AGGAATCTCTGACTCCAGAGGAGAAAGAGCTGTTAAATAAGATATGCAAAGCCTTCTATC 840

ABE41794        AGGAATCTCTGACTCCAGAGGAGAAAGAGCTGTTAAATAAGATATGCAAAGCCTTCTATC 823

                ************************************************************

 

JN620365        TTCCGGCTTGGTGTTCCACTGCTGATTATGTGAAGTTACTTCAATCCAATTCTCTTCAGG 883

GU358684        TTCCGGCTTGGTGTTCCACTGCTGATTATGTGAAGTTACTTCAATCCAATTCTCTTCAGG 888

GU563800        TTCCGGCTTGGTGTTCCACTGCTGATTATGTGAAGTTACTTCAATCCAATTCTCTTCAGG 888

DQ456876        TTCCGGCTTGGTGTTCCACTGCTGATTATGTGAAGTTACTTCAATCCAATTCTCTTCAGG 900

ABE41794        TTCCGGCTTGGTGTTCCACTGCTGATTATGTGAAGTTACTTCAATCCAATTCTCTTCAGG 883

                ************************************************************

 

JN620365        ATATCAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGT 943

GU358684        ATATCAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGT 948

GU563800        ATATCAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGT 948

DQ456876        ATATCAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGT 960

ABE41794        ATATCAAGGCAGAAGACTGGTCTGAGAATGTTGCTCCATTTTGGCCAGCAGTCATAAAGT 943

                ************************************************************

 

JN620365        CAGCACTGACATGGAAGGGCTTCACATCAGTACTACGCAGTGGATGGAAGACAATCAAAG 1003

GU358684        CAGCACTGACATGGAAGGGCTTCACATCAGTACTACGCAGTGGATGGAAGACAATCAAAG 1008

GU563800        CAGCACTGACATGGAAGGGCTTCACATCAGTACTACGCAGTGGATGGAAGACAATCAAAG 1008

DQ456876        CAGCACTGACATGGAAGGGCTTCACATCAGTACTACGCAGTGGATGGAAGACAATCAAAG 1020

ABE41794        CAGCACTGACATGGAAGGGCTTCACATCAGTACTACGCAGTGGATGGAAGACAATCAAAG 1003

                ************************************************************

 

JN620365        CTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCTCATCAAATTTGCCA 1063

GU358684        CTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCTCATCAAATTTGCCA 1068

GU563800        CTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCTCATCAAATTTGCCA 1068

DQ456876        CTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCTCATCAAATTTGCCA 1080

ABE41794        CTGCACTGGCAATGCCACTGATGATTGAAGGATACAAGAAAGGTCTCATCAAATTTGCCA 1063

                ************************************************************

 

JN620365        TCATCACATGTCGAAAACCTGAATAA---------------------------------- 1089

GU358684        TCATCACATGTCGAAAACCTGAATAATTATTGCTTAGCTACTGCGCG------------- 1115

GU563800        TCATCACATGTCGAAAACCTGAATAATTATTGCTTAGCTACTG----------------- 1111

DQ456876        TCATCACATGTCGAAAACCTGAATAATTATTGCTTAGCTACTGATGAATAATACAACATC 1140

ABE41794        TCATCACATGTCGAAAACCTGAATAA---------------------------------- 1089

                **************************                                 

شکل 3: همردیف سازی توالی نوکلئوتیدی cDNAی ژن گاما توکوفرول متیل ترنسفراز بین رقم Memory 1 ( با شماره دستیابی (JN620365 و دیگر اکسشن های ثبت شده از گوجه فرنگی در بانک NCBI.

 

 

 

 

GU563800        MGSQCYSAYSIQSLNPTCPSSSSSSVIFTLLKPQIHRRRIITCCNSSRRRRRMASVAAMN 60

GU358684        MGSQCYSAYSIQSLNPTCPSSSSSSVIFTLLKPQIHRRRIITCCNSSRRRRRMASVAAMN 60

DQ456870        MGSQCYSAYSIQSLNPTCPSSSSSSVIFTLLKPQIHRRRIITCCNSSRRRRRMASVAAMN 60

ABE41794        MGSQCYSAYSIQSLNPTCPSSSSSSVIFTLLKPQIHRRRIITCCNSSRRRRRMASVAAMN 60

JN620365        MGSQCYSAYSIQSLNPTCPSSSSSSVIFSLLKPQIHRRRIITCCNSSRRRRRMASVAAMN 60

                ****************************:*******************************

 

GU563800        AVSSSSVEVGIQNQQELKKGIADLYDESSGIREDIWGDHMHHGYYEPKSSVELSDHRAAQ 120

GU358684        AVSSSSVEVGIQNQQELKKGIADLYDESSGIREDIWGDHMHHGYYEPKSSVELSDHRAAQ 120

DQ456870        AVSSSSVEVGIQNQQELKKGIADLYDESSGIWEDIWGDHMHHGYYEPKSSVELSDHRAAQ 120

ABE41794        AVSSSSVEVGIQNQQELKKGIADLYDESSGIWEDIWGDHMHHGYYEPKSSVELSDHRAAQ 120

JN620365        AVSSSSVEVGIQNQQELKKGIADLYDESSGIREDIWGDHMHHGYYEPKSSVELSDHRAAQ 120

                ******************************* ****************************

 

GU563800        IRMIEQALSFAAISEDPAKKPTSIVDVGCGIGGSSRYLAKKYGATAKGITLSPVQAERAQ 180

GU358684        IRMIEQALSFAAISEDPAKKPTSIVDVGCGIGGSSRYLAKKYGATAKGITLSPVQAERAQ 180

DQ456870        IRMIEQALSFAAISEDPAKKPTSIVDVGCGIGGSSRYLAKKYGATAKGITLSPVQAERAQ 180

ABE41794        IRMIEQALSFAAISEDPAKKPTSIVDVGCGIGGSSRYLAKKYGATAKGITLSPVQAERAQ 180

JN620365        IRMIEQALSFAAISEDPAKKPTSIVDVGCGIGGSSRYLAKKYGATAKGITLSPVQAERAQ 180

                ************************************************************

 

GU563800        ALADAQGLGDKVSFQVADALNQPFPDGQFDLVWSMESGEHMPNKEKFVGELARVAAPGGT 240

GU358684        ALADAQGLGDKVSFQVADALNQPFPDGQFDLVWSMESGEHMPNKEKFVGELARVAAPGGT 240

DQ456870        ALADAQGLGDKVSFQVADALNQPFPDGQFDLVWSMESGEHMPNKEKFVGELARVAAPGGT 240

ABE41794        ALADAQGLGDKVSFQVADALNQPFPDGQFDLVWSMESGEHMPNKEKFVGELARVAAPGGT 240

JN620365        ALADAQGLGDKVSFQVADALNQPFPDGQFDLVWSMESGEHMPNKEKFVGELARVAAPGGT 240

                ************************************************************

 

GU563800        IILVTWCHRDLSPSEESLTPEEKELLNKICKAFYLPAWCSTADYVKLLQSNSLQDIKAED 300

GU358684        IILVTWCHRDLSPSEESLTPEEKELLNKICKAFYLPAWCSTADYVKLLQSNSLQDIKAED 300

DQ456870        IILVTWCHRDLSPSEESLTPEEKELLNKICKAFYLPAWCSTADYVKLLQSNSLQDIKAED 300

ABE41794        IILVTWCHRDLSPSEESLTPEEKELLNKICKAFYLPAWCSTADYVKLLQSNSLQDIKAED 300

JN620365        IILVTWCHRDLSPSEESLTPEEKELLNKICKAFYLPAWCSTADYVKLLQSNSLQDIKAED 300

                ************************************************************

 

GU563800        WSENVAPFWPAVIKSALTWKGFTSVLRSGWKTIKAALAMPLMIEGYKKGLIKFAIITCRK 360

GU358684        WSENVAPFWPAVIKSALTWKGFTSVLRSGWKTIKAALAMPLMIEGYKKGLIKFAIITCRK 360

DQ456870        WSENVAPFWPAVIKSALTWKGFTSVLRSGWKTIKAALAMPLMIEGYKKGLIKFAIITCRK 360

ABE41794        WSENVAPFWPAVIKSALTWKGFTSVLRSGWKTIKAALAMPLMIEGYKKGLIKFAIITCRK 360

JN620365        WSENVAPFWPAVIKSALTWKGFTSVLRSGWKTIKAALAMPLMIEGYKKGLIKFAIITCRK 360

                ************************************************************

 

GU563800        PE 362

GU358684        PE 362

DQ456870        PE 362

ABE41794        PE 362

JN620365        PE 362

                **

شکل 4: همردیف سازی توالی اسید آمینه ای منتج شده از cDNAی ژن گاما توکوفرول متیل ترنسفراز بین رقم Memory 1 ( با شماره دستیابی (JN620365 و دیگر اکسشن های ثبت شده از گوجه فرنگی در بانک .NCBI

 

 

 

بررسی درخت فیلوژنتیکی ژن گاما توکوفرول متیل ترانسفراز با استفاده از نرم افزار Clustalw صورت گرفت. به همین منظور از ژن های گاما توکوفرول متیل ترانسفراز دیگر گیاهان ثبت شده در NCBI استفاده شد (شکل 5). بررسی های انجام شده با استفاده از نرم افزار Clustalw نشان داد که پروتئین منتج از ژن همسانه سازی شده با پروتئین های ثبت شده مشابه در بانک ژنNCBI ، 32 تا 5/99 درصد تشابه دارد. ژن توالی یابی شده با داشتن 5/99 و 6/98 درصد، بیشترین تشابه را به ترتیب با توالی‏های Solanum penellii وSolanum tuberosum با شماره ی دستیابی ADZ24710 و ADV36922 و کمترین تشابه را با Synechococcus با 32 درصد، نشان داد. ساختار دوم پروتئین در اثر فعل و انفعالات پیوند هیدروژنی باقی مانده اسیدهای آمینه در داخل یا بین زنجیره های پپتیدی ایجاد می شود. پیش بینی ساختار دوم پروتئین ژن هدف با استفاده از نرم افزار آنلاین PSIpred صورت گرفت و نتایج نشان داد که این پروتئین از 16 مارپیچ آلفا، 8 صفحه ی بتا و 23 کویل تشکیل شده است (شکل 6).


 

 

شکل 5: درخت فیلوژنتیک پروتئین گاما توکوفرول متیل ترانسفراز گیاهان موجود در NCBI. I. توالی هایی که با پروتئین منتج شده از ژن توالی یابی شده 30تا40 درصد شباهت دارند. II. توالی هایی که با پروتئین ژن توالی یابی شده 40تا50 درصد شباهت دارند، III. توالی هایی که با پروتئین ژن توالی یابی شده 50تا60 درصد شباهت دارند، IV. توالی هایی که با پروتئین ژن توالی یابی شده 70تا80 درصد شباهت دارند V توالی هایی که با پروتئین ژن توالی یابی شده 80 تا90 درصد و VI توالی هایی که با پروتئین ژن توالی یابی شده 90تا99 درصد شباهت دارند. * توالی پروتیین مورد بررسی.

 

شکل6: پیش بینی ساختار دوم پروتئین گاما توکوفرول متیل ترانسفراز با استفاده از نرم افزار آنلاین .PSI pred

 

 

شکل 7: ساختار سوم آنزیم گاما توکوفرول متیل ترانسفراز با استفاده از نرم افزار آنلاین .PSI pred

 

مدل سازی تطبیقی، روشی معتبر برای پیش بینی ساختار سه بعدی پروتئین ها بر اساس توالی اسید آمینه می باشد. برای ترسیم ساختار سوم پروتئین ژن هدف توالی اسیدآمینه ای آنزیم گاما توکوفرول متیل ترانسفراز در سایت PS2 مورد بررسی قرار گرفت و آنزیم سارکوزین دی متیل گلایسین متیل ترانسفراز Galdieria sulphuraria (PDB 2O57) با 21 درصد شباهت به عنوان الگو در نظر گرفته شد (شکل 7).

 

بحث

در گیاهان فتوسنتز کننده، توکوفرول ها در پاسخ به بسیاری از تنش های غیر زنده افزایش نشان می دهند؛ از جمله نور شدید (22) خشکی (23) و دماهای پایین و بالا (24).  بیشتر توکوفرول ها در گیاهان در پلاستید ها قرار دارند، تنها استثنا در این مورد، گیاهان دانه روغنی است که توکوفرول‏ها در دانه این گیاهان به صورت ذرات روغن (oil bodies) که از شبکه آندوپلاسمی منشا می‏گیرند، ذخیره می شوند (14). این مطالعه با هدف همسانه سازی ژن گاماتوکوفرول متیل ترنسفراز از گیاه گوجه فرنگی، مطالعه و تعیین خصوصیات بیوشیمیایی و ملکولی پروتئین منتج از آن و در نهایت، انتقال آن به یک گیاه دانه روغنی، در پژوهش های آینده صورت گرفت. انتقال این ژن (گاما توکوفرول متیل ترنسفراز) می تواند هم ارزش غذایی گیاه را به دلیل تولید بیشتر آلفا توکوفرول بالا ببرد و هم از نظر افزایش مقاومت گیاه در مقابل تنش ها، مفید واقع شود.

ژن همسانه سازی شده با ژن های ثبت شده گوجه فرنگی در بانک ژن 98 درصد شباهت را نشان داد. تفاوت هایی در موقعیت های 84، 273، 561 و 642 در بین توالی های نوکلئوتیدی همردیف سازی شده بین ژن ثبت شده در این پژوهش با شماره دستیابی JN620365، با ژن ثبت شده با شماره دستیابی DQ456876 که به عنوان توالی مرجع استفاده شده بود، مشاهده گردید (شکل 3). این تفاوت ها به ترتیب شامل جایگزینی یک نوکلئوتیدA  به جای T، یک نوکلئوتید C به جای T، یک نوکلئوتید A به جای G و یک نوکلئوتید C به جای G می شد. این تغییرات به ترتیب باعث تبدیل کدون ACT به TCT، کدون TGG به CGG، کدون GGA به GGG و TCC به TCG شده اند (شکل 4). در دو موقعیت 84 و 273 جایگاه اول کدون و در موقعیت 561 و 642 جایگاه سوم کدون تغییر یافته اند. تغییر در جایگاه 84 موجب تبدیل اسید آمینه ی ترئونین به سرین، در جایگاه 273 اسیدآمینه ی تریپتوفان به آرژنین و در موقعیت های 561 و 642، به ترتیب، کدون گلایسین و سرین به کدون های دیگری از همین اسیدهای آمینه تبدیل شده اند (شکل های 4 و 5). در بین چهار تغییری که در کدون ها رخ داده بود، تنها دو کدون، اسیدهای آمینه متفاوتی را بوجود می آورند. تبدیل اسید آمینه ترئونین به سرین (تغییر در جایگاه 84) شاید باعث تغییر عمده ای در ساختار و عملکرد پروتئین حاصله نشود؛ زیرا هر دوی این اسید های آمینه از نظر ساختاری بسیار به هم شبیه و جزو اسید های آمینه قطبی بدون بارند. اما تبدیل اسید آمینه تریپتوفان به آرژنین (تغییر در جایگاه 273) می تواند تغییر اساسی در ساختار و در نتیجه در عملکرد پروتئین حاصله داشته باشد؛ زیرا تریپتوفان جز اسیدهای آمینه آبگریز و آرژنین جز اسیدهای آمینه بازی دارای بار مثبت است. چنین جایگزینی یک تغییر عمده در قسمتی از ساختار و خصوصیت بیوشیمی یک پروتئین محسوب می‏شود. این تغییر در سه اکسشن دیگر گوجه فرنگی هم به چشم می‏خورد (شکل 5). حال این که کدام یک از این آیزوفرم ها می تواند گاما توکوفرول را به آلفا توکو فرول تبدیل نماید و یا با کارآیی بیشتری این عمل را انجام دهد، به انتقال این آیزوفرم ها به گیاهان جهش یافته‏ی فاقد این ژن و بررسی میزان تولید آلفا تو کوفرول در آن‏ها نیاز دارد. در هر صورت، پروتئین حاصله دارای 362 اسید آمینه و وزن ملکولی حدود kD 39 است که با پروتئین های مشابه از گیاه فلفل زنگوله ای با وزن ملکولیkD  33 (10) و پروتئین فلفل دلمه‏ای با وزن ملکولی  kD36 (25) مشابهت دارد.

مشاهده گردید که ژن به دست آمده در این مطالعه دارای توالی راهنمای پلاستیدی است. این یافته با حضور توکوفرول ها در کلروپلاست مطابقت دارد (14)، به این معنی که این آنزیم باید جهت تبدیل گاما توکوفرول به آلفا توکوفرول، به مکان سوبسترای خود (درون کلروپلاست)، حمل گردد. توکوفرول های آلفا، بتا، گاما و دلتا دارای فعالیت آنتی اکسیدانتی مختلفی دربرابر اکسایش لیپیدها در شرایط in vivo دارند. هر ملکول از این توکوفرول‏ها می‏تواند به ترتیب علیه 220، 120، 100 و 30 ملکول PUFA (polyunsaturated fatty acid) فعالیت داشته باشد. همچنین پیشنهاد شده که توکوفرول‏ها نقش مهمی را در محافظت از دستگاه فتو سنتزی گیاه دارند و دیده شده است که در پا سخ به تنش‏های غیر زنده مانند خشکی و وجود فلزات سنگین افزایش نشان می دهند (26). تبدیل گاما توکوفرول به شکل فعال‏تر آن یعنی آلفا توکوفرول توسط آنزیم گاما توکوفرول متیل ترنسفراز صورت می‏گیرد (16) که انتقال این ژل به گیاهان هدف، از جمله گیاهان دانه روغنی می‏تواند در افزایش خاصیت تغذیه ای و عملکرد آن ها در شرایط سخت نقش مهمی را ایفا نماید.

 

نتیجه­گیری

آلفا توکوفرول ماده ضد اکسنده قوی است که طی واکنش بیوشیمیایی از گاما توکوفرول ساخته می شود. با افزایش میزان این آنزیم از طریق مهندسی ژنتیک می توان محتوای ویتامین E گیاه و مقاومت آن را در برابر تنش های محیطی بالا برد. مهندسی ژنتیکی را می توان جایگزین بالقوه‏ی منبع ویتامین E با فرض تولید مقرون به صرفه‏ی اقتصادی نسبت به تولید شیمیایی آلفاتوکوفرول در نظر گرفت. در میان گیاهان دانه روغنی بعلت غنی بودن از گاما توکوفرول بهترین هدف تولید اقتصادی توکوفرول ها از طریق مهندسی مسیر بیوسنتزی آنها می باشد. بنابراین برای ابربیان ژن گاما توکوفرول متیل ترانسفراز در گیاهان مذکور باید ژن همسانه سازی شده در ناقل pBluescript را به یک ناقل بیانی همسانه سازی کرد و به گیاهان دانه روغنی انتقال داد.

 

تشکر و قدر‌دانی

هزینه این پژوهش از بودجه گروه بیوتکنولوژی کشاورزی دانشگاه بین المللی امام خمینی (ره) تامین گردید که به این وسیله تشکر می‏گردد.

 

 

1.   Traber MG, Sies H. Vitamin E and humans: demand and delivery. Annu Rev Nutr. 1996; 16: 321–347.

2.   Dutta-Roy AK, Gordon MJ, Leishman DJ, Duthie GG, et al. Purification and partial characterization an α-tocopherol binding protein from rabbit heart cytosol. Mol Cell Biochem.1993; 123:139–44.

3.   Burton GW, Ingold KU. Vitamin E as an in vitro and in vivo Antioxidant. Ann NY. Acad. Sci. 1989; 570: 7-22.

4.   Stahelin, HB, et al. Cancer Mortality and Vitamin E Status. Ann. N.Y. Acad. Sci. 1989; 570: 391-99.

5.   Wang YeuMing, Purewal M, Nixon B, Li H, et al. Vitamin E and cancer prevention in an animal. Model. Ann NY. Acad. Sci. 1989; 570: 383-91.

6.   Cross CE, Halliwell B, Borish ET, Pryor WA, et al. Oxygen radical and human disease. Ann. Inter. Med. 1987; 107: 526-45.

7.   Arango Y, Heise K. Localization of alpha-tocopherol synthesis in chromoplast envelope membrane of Capsicum annum L. Fruits J Exp Bot. 1998; 49: 1259-1262.

8.   Shintani D, DellaPenna D. Elevating the vitamin E content of plants through metabolic engineering. Science.1998; 282: 2098-2100.

9.   Soll J, Kemmerling M, Schultz G. Tocopherol and plastoquinone synthesis in spinach chloroplasts subfractions. Arch Biochem Biophys. 1980; 204: 544–550.

10. Soll J, Schultz G, Joyard J, Douce R, et al. Localization and synthesis of prenylquinones in isolated outer and inner envelop membranes from spinach chloroplasts. Arc Biochem Biophys. 1985; 238: 290-299.

11. d’Harlingue A, Camara B. Plastid enzymes of terpenoid biosynthesis. J Biol Chem. 1985; 260: 15200-15203.

12. Kurk j, Hollander-Czytko H, Oett meier W, Trebst A. Tocopherol as singlet oxygen scavenger in photosystem II. J Plant Physiol. 2005; 162: 749-757.

13. Matringe M, Ksas B, Rey P, Havaux M. Tocotrienols, the unsaturated forms of vitamin E, can function as antioxidants and lipid protectors in tobacco leaves. Plant Physiol. 2008; 147: 764-778.

14. Maeda H, Song W, Sango TL, Dellapenna D. Tocopherols play a crucial role in low-temperature adaptation and phloem loading in Arabidopsis. Plant Cell. 2006; 18: 2710-2732.

15. Kim MJ, Baek SH, Yoo NH, Yun SJ. Transformation of Arabidopsis gamma-tocopherol methyltransferase into lettuce (Lactuca sativa L.) Korean J Plant Tiss Cult. 2005; 27: 435-439.

16. Yusuf MA, Sarin NB. Antioxidant value addition in human diets: genetic transformation of Brassica juncea with γ-TMT gene for increased α -tocopherol content. Transgenic Res. 2007; 16: 109-113.

17. Lee BK, Kim SL, Kim KH, YU SH, et al. Seed specific expression of perilla gamma-tocopherpl methyltransferase increases alpha-tocopherol content in transgenic perilla (Perilla frutescens). Plant Cell Tiss Organ Cult. 2008; 92: 47-54.

 

18. Ghimirie BK, Seong ES, Lee CO, Lim JD, et al. Enhancement of α-tocopherol content in transgenic Perilla frutescens containing the γ-tmt gene. 2011; 10: 2430-2439.

19. Tavva VK, Kim YH, Kagan IA, Dinkins RD, et al. Increased alpha-tocopherol content in soybean seed over expressing the Perilla frutescens gamma-tocopherol methyltransferase gene. Plant Cell Rep. 2007; 26: 61-70.

20. Reid KE, Olsson N, Schlosser J, Peng F, et al. An optimized grapevine RNA isolation procedure and statistical determination of reference genes for real time RT-PCR during berry development. BMC Plant Biol. 2006; 6: 27. doi: 10.1186/1471-2229-6-27.

21. Sambrook J, Russel DW. Molecular cloning: A laboratory manual, 3rd edition, Cold Spring Harbor Laboratory Press, New York, USA. 2001; 1524- 1526.

22. Ledford HK, Baroli I, Shin JW, Fischer BB, et al. Comparative profiling of lipid –soluble antioxidants and transcripts reveals two phases of photo-oxidative stress in a xanthophylls-deficient mutant of Chlamydomonas reinhardtii. Mol Genet Genomics. 2004; 272: 470-479.

23. Munne-Bosch S, Schwarz K, Alegre L. Enhanced formation of α-tocopherol and highly oxidized abietane diterpene in water-stressed rosemary plants. Plant Physiol. 1999; 121: 1047-1052.

24. Bergmuller E, Porfirova S, Dormann P. Characterization of an Arabidopsis mutant deficient in γ-tocopherol methyltransferase. Plant Mol Biol. 2003; 52: 1181-1190.

25. Koch M, Lemek R, Heise K, Mock H. Characterization of γ-tocopherol methyltransferases from Capsicum annuum and Arabidopsis thaliana. Eur J Biochem. 2003; 270: 84-92.

26. Yusuf MA, Kumar D, Rajwanshi R, Strasser RJ, et al. Overexpression of γ-tocopherol methyltransferase gene in transgenic Brassica juncea plants alleviates abiotic stress: physiological and chlorophyll a fluorescence measurements. Biochemica et Biophysica Acta. 2010; 1797: 1428-1238.