کلون و بیان ژن نوترکیب هومون رشد با استفاده از برچسب تیوردوکسین

نوع مقاله: علمی - پژوهشی

نویسندگان

پژوهشکده‌ی علوم و فناوری زیستی، دانشگاه صنعتی مالک اشتر، تهران، ایران

چکیده

هدف: در قرن حاضر، تولید داروهای نوترکیب افزایش یافته است. از جمله این داروها، هورمون رشد می‏باشد که به‏علت مشکلاتی که در پروسه­ی بیان نوع سیتوپلاسمی و پری پلاسمی این پروتئین وجود دارد، یافتن راه حلی که بتواند بیان را بهینه نماید ضروری به‏نظر می‏رسد. لذا در این تحقیق با استفاده نمودن از trx-tag بیان هورمون رشد را به‏صورت محلول بهینه شد که علاوه بر افزایش بیان پرتئین (حل مشکل پری پلاسمی) از تشکیل انکلوزیون بادی (مشکل سیتوپلاسمی) جلوگیری می‏نماید.
مواد و روش­ها: سنتز ژن و کاست ژنی به‏منظور بیان هورمون رشد در سیستم بیانی pET 32a صورت گرفت. کاست ژنی شاملtrx-tag  برای محلول سازی پروتئین،His tag  به‏منظور خالص سازی و انتروکیناز در ابتدای ژن rHgh به‏منظور جداسازی برچسب های قبلی از این پروتئین می‏باشد.
نتایج: بعد از کلون سازی این ژن در وکتور و بیان آن، تایید آن توسط وسترن بلات صورت گرفت. نتایج به‏دست آمده با استفاده از نرم افزارهای آنالیز ژل درصد بیانی حدود  از کل بیان را در سویه نوترکیب نشان می­دهد.
نتیجه گیری: در این تحقیق، نشان داده شد که با استفاده از Trx-tag می‏توان پروتئین را به‏حالت محلول در آورد و میزان بیان را بالا برد در ادامه با انجام مراحل  تخمیر و پایین دستی می‏توان به نتایج بهتری دست یافت.
 

تازه های تحقیق

-

کلیدواژه‌ها


مقدمه

رشد یعنی افزایش اندازه بافت یا ارگانیسم که ناشی از افزایش در اندازه سلول، در تعداد سلول، ماتریکس خارج سلولی در اطراف سلول‏ها است. هورمون مهمی که رشد عمومی را در بدن تنظیم می‏کند، هورمون رشد می‏باشد. هورمون رشد انسانی یا سوماتوتروپین یک زنجیره پلی پپتید متشکل از 191 آمینواسید با وزن مولکولی 22 کیلودالتون می‏باشد که توسط بخش پیشین غده درون ریز هیپوفیز ساخته و ترشح می‏شود. این هورمون علاوه بر رشد سلولی دارای نقش مهمی در انواع روند‏های متابولیک فیزیولوژیک و آناتومیک می‏باشد (1و2).

فراوان ترین نوع سلول‏ها در غده هیپوفیز سلول‏های اسیدوفیل سازنده هورمون رشد هستند که سوماتروتروف نامیده می‏شوند. غلظت پلاسمای هورمون رشد در حدود 3 تا 5 نانوگرم بر میلی‏لیتر است. ترشح هورمون از این سلول‏ها به‏صورت پالسی می‏باشد که تحت تأثیر عوامل گوناگونی قرار دارد. در فواصل بین دو تناوب مقدار این هورمون ناچیز بوده و بیشترین غلظت سرمی آن در فاز عمیق خواب مشاهده می‏شود. ترشح هورمون رشد توسط یک مکانیسم تنظیم‌کننده دوگانه هیپوتالاموس کنترل‌می‏شود.بدین‌صورت‌که فاکتور آزادکننده‌آن سبب‌تحریک و فاکتور مهار کننده موجب توقف‌ترشح آن می‏شود (3).

در سال‏های اخیر‏، تولید پروتئین‏های انسانی با استفاده از تکنولوژی DNA نوترکیب در میزبان‏های باکتریایی‏، قارچی‏، مخمری و حتی جانوری افق تازه ای برای تولید محصولات دارویی به‏منظور بهبود زندگی بشر پیش روی محققان قرار داده است (4 و 5). در دنیای امروز تقاضا برای داروهای زیستی روز به‏روز در حال افزایش است، درحالی‏که هزینه‏های بالای تولید و مسیرهای بیوسنتزی داروهای نوترکیب امکان دسترسی به این نسل از داروها را کاهش داده است(6). از آنجایی‏که یک ژن می‏تواند در سیستم‏های گوناگونی بیان شود، تعیین سیستمی با بیشترین بازده تولید پروتئین‏های نوترکیب امری ضروری می‏باشد که می‏تواند در‏ کاهش هزینه‏های تولید دارو نقش به‏سزائی داشته باشد (7). تعیین بهترین سیستم بیان کننده پروتئین‏های نوترکیب یکی از مباحث مهم در بیوتکنولوژی است. یک سیستم بیان کننده پروتئین‏های نوترکیب باید بتواند مواد زیستی را با بیشترین فعالیت زیستی، ایمنی و کمترین هزینه تولید کند (7 ‏و 8).

از آنجایی‏که قیمت داروهای زیستی به‏دست آمده از سیستم‏های کشت سلول‏های حیوانی یا گیاهی فراوانی آن‏ها را محدود می‏کند. بنابراین توسعه سیستمی که بتواند این داروها را با قیمت و فراوانی مناسب در اختیار مصرف کنندگان قرار دهد امری ضروری می‏باشد (9). تولید مقادیر بالایی از پروتئین نوترکیب با هزینه کشت کمتر در سیستم‏های کشت باکتریایی در فرمانتور قابل انجام است(10).

هورمون رشد یکی از این پروتئین‏های انسانی است که می‏توان با استفاده از روش‏های نوین مهندسی ژنتیک آن را تولید کرد. ژن هورمون رشد هیپوفیزی، 651 نوکلئوتید طول دارد که 78 نوکلئوتید اول آن مربوط به پپتید نشانه است که بعد از ترجمه جدا می شود (11). برای تولید شکل نوترکیب این پروتئین در سال‏های گذشته مطالعات بسیاری انجام شده است که سیستم‏های بیانی پروکاریوتی و یوکاریوتی متفاوتی برای تولید این هورمون مورد استفاده قرار گرفته اند.

در مطالعه‏ی انجام شده ،بیان هورمون رشد در باکتری اشرشیا کلی مورد بررسی قرار گرفته است. یکی از چالش‏های استفاده از سیستم‏های پروکاریوتی، تولید پروتئین نوترکیب به شکل انکلوزیون بادی در داخل باکتری است که در این‏حالت به‏علت نبود فولدینگ صحیح، پروتئین فعالیت بیولوژیکی مناسبی نداشته و باید مراحل فولدینگ بر روی پروتئین تولیدی انجام شود که این پروسه علاوه بر افزایش زمان و هزینه‏، باعث کاهش بازده هم می‏شود. زیرا مقداری از پروتئین تولید شده در طی مراحل بعدی از دست می‏رود. در این مقاله برای حل مشکل از تیوردوکسین استفاده شده است که به‏عنوان یک برچسب بسیار مفید در جلوگیری از شکل گیری انکلوزیون بادی در تولید پروتئین نوترکیب است.

تیوردوکسین پروتئین مقاوم به حرارت ، 12کیلو دالتونی است که به‏راحتی بیان و محلول می‏شود حتی زمانی که تا 40 درصد از مجموع پروتئین سلولی بیان می‏شود. این پروتئین در باکتری‏ها، گیاهان و اندام‏های حیوانی موجود است (12) .گزارش شده تیوردوکسین در همه بخش‏های سلول باکتری، یعنی سیتوپلاسم، منطقه کروموزومی و پری پلاسم وجود دارد. تحقیقات نشان می­دهد که برچسب TRX هنگامی‏که در-N ترمینال پروتئین هدف قرار داده می‏شود مؤثرتر است. تیوردوکسین در سایت‏های چسبندگی غشای سیتوپلاسمی تجمع می‏یابد تا اجازه دهد پروتئین‏های فیوژن با  TRX توسط شوک اسمزی و یا تیمار  سرد / گرم شدن  به‏راحتی منتشر شوند که منجر به انجام مرحله اولیه تخلیص می­‏شود (12-14).

تیوردوکسین به‏عنوان  فیوژن پروتئین در جلوگیری از تشکیل انکلوزیون بادی، به‏ویژه برای تولیدات کم مانند ترشح سایتوکاین فعال پستانداران در سیتوپلاسم باکتری اشرشیاکلی مفید می‏باشد. تیوردوکسین اشرشیاکلی پروتئین فشرده، بسیار محلول و پایدار حرارتی با ویژگی‏های فولدینگ قوی می‏باشد. این خواص اجازه می­دهد مولکول، هنگامی‏که به پروتئین مورد نظر متصل می شود، به‏عنوان مولکول چاپرون با اتصال کووالانت عمل کند (13).

مواد و روش­ها

سنتز ژن و ساختار پلاسمی: توالی ژن موردنظر از پایگاه داده‏ی DRUGBANK کسب شد (15) و با استفاده از پایگاه داده ی Genescript توالی به‏دست آمده (شکل1) با توجه به میزبان‏های مورد استفاده از نظر کدون‏های بیان بهینه سازی و به شرکت پویا ژن آزما برای سنتز سفارش داده شد. پلاسمید  pET32a جهت همسانه سازی و بیان مورد استفاده قرار گرفت. وکتور بیانی طراحی شده (شکل 2) دارای Trx tag در بالادست محل ورود ژن hGH+ انتروکیناز است که بعد از بیان باعث افزایش محلول شدن توده پروتئین هدف شده که در ادامه کار، مرحله فولدینگ و اوره زدائی را تسهیل می‏کند. به‏علاوه در کنار برچسب یاد شده این پلاسمید حاوی His6 tagنیز می‏باشدکه در مرحله تخلیص با استفاده از ستون نیکل مورد استفاده قرار خواهد گرفت. در کاست بیانی طراحی شده بین تگ‏های یادشده و ابتدای‌ژن hGH  توالی‌جایگاه‌برش‌اختصاصی آنزیم‌انتروکیناز(Asp-Asp-Asp-Asp-Lys) قرار داده شد.

 

DDDDKFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

شکل 1: توالی پروتئین هورمون رشد همراه با انتروکیناز

 

شکل2: تصویر شماتیک از وکتور نوترکیب طراحی شده

 

تکثیر ژن rhGH: به‏منظور تکثیر ژن hGH و قرار دادن جایگاه برش مربوط به آنزیم‌های Xho1 و BamH1 ،  واکنش زنجیره‌ای پلیمراز با استفاده از پرایمر­های پیشرو: AAGCGGATCCTGATGACGATGACAAG و پسرو: AGGTCTCGAGATTAAAAGCCACAACTCC و مطابق جدول 1 انجام شد.

 

جدول 1: شرایط دمایی به‏منظور تکثیر ژن rhGH.

                  Program  

temperature

time

           Initial denaturing

94°C

5'

 

 

8 cycle

 

              Denaturing

                         94°C

30''

 A           Annealing

                          50°C

30''

               Extension

72°C

30''

 

17 cycle

 

Denaturing

94°C

30''

Annealing

55°C

30''

Extension

72°C

30''

Final extension

72°C

5'

         

 

ترانسفورماسیون و تایید آن با استفاده از کلنی PCR: بعد از تکثیر قطعه ژنی و پلاسمید، هضم آنزیمی پلاسمید pET32a با استفاده از دو آنزیم Xho1 و BglIIو هضم آنزیمی ژن rhGH با استفاده از Xho1 و BamH1 صورت گرفت .قطعات مربوطه ژن و پلاسمید از روی ژل آگارز جدا شده و قطعات با استفاده از آنزیم T4 به‏هم الحاق شدند. محصول الحاق به‏داخل باکتری مستعد شده­ی اشرشیاکلی سویه­ی رزتاگامی ترانسفورم شد. کلنی‏های تشکیل شده حاوی پلاسمید نوترکیبی که ژن hGH در آن وارد شده می‏باشند. برای تائید ترانسفورماسیون از کلنی­های تشکیل شده به‏شکل تصادفی با استفاده از پرایمر­های قسمت قبل کلنی PCR انجام شد که نتایج به‏دست آمده صحت وجود وکتور نوترکیب را در کلنی­های حاصله تایید کردند.

بیان پروتئین توسط SDS PAGE  و تایید آن با روش وسترن بلات: برای بررسی اولیه بیان پروتئین نوترکیب، باکتری ترانسفورم شده‏ی رزتاگامی در 5 میلی‏لیتر محیط کشت Lb Broth در دمای 37 درجه سانتی‏گراد گرماگذاری و بعد از 16 ساعت 250 میکرولیتر از آن عنوان مایه تلقیح به 10 میلی‏لیتر محیط کشت (­1/0 گرم تریپتون، 05­/0گرم عصاره مخمر و 1/0 گرم سدیم کلرید) اضافه شد. در 6 /0OD= بعد از نمونه‏گیری‏، بیان با غلظت 1 میلی مولار از IPTG القا و بعد از 4 ساعت در 8/1OD= نمونه گیری از باکتری القا شده انجام شد. با توجه به اندازه پروتئین فیوژ شده (40 کیلو دالتون) ژل پلی اکریل آمید 5/14 درصد برای بارگذاری نمونه ها مورد استفاده قرار گرفت. نمونه‏های پروتئین بعد از بارگذاری بر روی ژل با اختلاف پتانسیل 85 به‏مدت 3 ساعت الکتروفورز شدند. به‏منظور تایید پروتئین بیانی با استفاده از روش وسترن بلات، نمونه‏ها بر روی ژل دیگری بارگذاری شده و پروتئین‏های مربوطه به‏مدت 16 ساعت با جریان 220 میلی آمپر بر روی PVDF انتقال یافت. کاغذ را به‏مدت یک ساعت در محلول BSA، 3 درصد بلاک شد. بعد از سه بار شسستشو با استفاده از TBS-T، کاغذ به‏مدت یک ساعت در آنتی­بادی اول- Anti His(Roche)با نسبت 1:6000 در دمای اتاق گرماگذاری گردید. سپس بعد از سه مرحله شستشوی مجدد کاغذ در آنتی بادی دوم- anti Rabbit (Roche) با نسبت 1:10000 گرماگذاری شد. بعد از شستشوی مجدد 10 میلی لیتر DAB   (Fluka)با غلضتmg/ml   1/0 میلی‏گرم بر میلی‏لیتر به کاغذ اضافه و بعد از 5 دقیقه باند نهایی مشاهده شد.

نتایج

تکثیر ژنrhGH با استفاده از PCR

طبق شرایط ذکر شده در قسمت مواد و روش‏ها، برای تکثیر ژن hGH ، PCR انجام شد و نتایج آن با استفاده از ژل آگارز 1 درصد بررسی شد که نتیجه حاصله در شکل 3 مشاهده می‏شود.

 

                                                           

شکل3: ستون 1 باند 670 جفت باز تکثیر شده مربوط به ژن hGH، ستون 2 مارکر یک کیلو باز

 

بررسی نتیجه بیان

نمونه‏های بیان ژن rhGH با استفاده از  ژل SDSPAGE مورد بررسی قرار گرفت. وجود باند 40 کیلو دالتونی در زمان 4 ساعت پس از القا و عدم وجود باند در نمونه قبل از بیان  در زمان صفر قبل از القا نشان از بیان پروتئین نوترکیب دارد. شکل 4 نشان دهنده باند مربوط به هورمون رشد است.

 

 

شکل4: بیان هورمون رشد نوترکیب در باکتری اشرشیاکلی رزتاگامی حامل وکتور .pET32arhGH ستون1، باکتری قبل از القا. ستون 2، باکتری  4 ساعت بعد از القا. ستون 3 مارکر پروتئینی می­باشد.

 

نتیجه لکه گذاری وسترن

برای بررسی صحت نتایج ژل پلی اکریل آمید وسترن بلات همان نمونه‏ها بر روی غشا نیتروسلولزی انجام شد که طی نتیجه به‏دست آمده باند مشاهده شده در سایز مورد نظر صحت بیان پروتئین نوترکیب هورمون رشد انسانی را در سویه بیانی نشان می دهد .نتیجه نهایی وسترن بلات در شکل 5 آمده است.

 

 

شکل 5: نتیجه نهائی وسترن بلات. ستون 1، پروتئین مارکر، ستون 2، باند تایید بیان پروتئین

 

بحث

در حال حاضر هورمون رشد مورد نیاز کشور از طریق واردات تامین می‏شود. بنابر گزارش وزارت بهداشت در سال 82 بیش از سه میلیون دلار صرف واردات هورمون رشد شده است که این مقدار نیز جوابگوی نیاز داخل نبود. همچنین در سال 92 مبلغ 80 میلیارد تومان صرف واردات هورمون رشد شده است. مطابق لیست نیازمندی‏های وزارت بهداشت در سال1394، داروی هورمون رشد یا سوماتوتروپین، در اولویت تولید داخل کشور قرار گرفته است.

از آنجا‏که تولید این هورمون در بدن با افزایش سن به‏طور شدید کاهش می‏یابد. لذا امروزه تولیدآن از اهمیت زیادی برخوردار است و فرد می‏تواند اثراتی مانند افزایش حجم ماهیچه‏های بدن بدون ورزش، کاهش توده چربی بدون رژیم غذایی، افزایش استحکام استخوان‏ها، رفع چین و چروک پوست، بهبود عملکرد قلب، کلیه و کبد، افزایش قدرت جنسی و بهبود وضعیت کلسترول و فشار خون را با مصرف بهینه هورمون رشد تجربه کند.

این هورمون توسط شرکت‏های دارو­سازی مختلف تولید می‏شود. بیشتر به‏صورت انکلوزیون بادی می‏باشد و در حالت تخلیص ایجاد مشکل می‏نماید و یا تولید به‏صورت پری پلاسمی می‏باشد که میزان بیان آن در هر میلی‏لیتر محیط کشت بسیارکم می‏باشد.

در سال 1981 یک شرکت آمریکائی به‏نام Genetech آزمایش‏های وسیعی را برای تولید هورمون رشد سنتتیک با استفاده از تکنولوژی DNA نوترکیب شروع کرد (16).

اولین کار مهمی که در زمینه ساخت هورمون رشد نوترکیب صورت گرفت توسط ژئودل و همکاران (17) انجام شد که از یک ساختار ترکیبی متشکل از cDNA به‏دست آمده از mRNA هیپوفیز پیشین و قطعه‏ای DNA که به‏طور شیمیایی ساخته شده بود استفاده کردند.

از آنجا‏که بسیاری از پروتئین‏های باکتریایی فاقد متیونین اولیه هستند، دانشمندان تصور می‏کردند که این اسیدآمینه اضافی نیز ممکن است با مکانیسمی مشابه حذف شود، ولی این اتفاق نیفتاد. هر چند که فعالیت بیولوژیکی این پروتئین در شرایط درون شیشه‏ای به اثبات رسیده است، ولی مطالعات بعدی نشان می‏دهد که حضور این متیونین می‏تواند سبب تشکیل آنتی بادی بر علیه هورمون رشد متیونین دار در بیمارانی شود که با این پروتئین تیمار شده اند (18 و 19) .این موضوع توجه گروه تحقیقاتی را به‏سمت روش­هایی همچون استفاده از هدفمند سازی پروتئین به‏سمت یک بخش خاص با به‏کارگیری توالی­های نشانه جلب کرد که بتواند هورمون رشد را صحیح و بی نقص تولید کند.

اولین فرم نوترکیب هورمون رشد، پروتروپن از شرکت Genetech بود که برای اولین بار در سال 1985 وارد بازار شد. با افزایش تولید هورمون رشد انسانی نوترکیب این هورمون در بیماران با نقص و کمبود هورمون رشد مورد استفاده قرار گرفت. امروزه از میان سیستم‏های بیان کننده پروتوئین نوترکیب، سیستم بیانی باکتری اشرشیاکلی مورد توجه می‏باشد (17).

هورمون‏های رشد سنتتیک قابل دسترس و تولید‏ کنندگان آن شامل Nutropin (Genetech), Humatrope (Liily), Gentropin (Pfizer), Tev-tropin (Teva), Saizen (Serono همه‏ی این موارد به‏صورت پری پلاسمی تهیه می­‏شوند و Norditropin (NoVo)  به‏حالت سیتوپلاسمی می‏باشد. این فراورده ها از نظر ترکیب، اثر و قیمت یکسان هستند و مهم‏ترین تفاوت آن‏ها در فرمولاسیون و سیستم آزاد­سازی می‏باشد(20).

تیوردوکسین در جلوگیری از تجمع و رسوب پروتئین­های نوپای فیوژ شده، نقش دارد. در نتیجه، به آن‏ها فرصت زیادی برای آداپته شدن با فولدینگ‏شان می­دهد. تیوردوکسین دارای ویژگی­هایی است که آن را به‏عنوان شریک فیوژن مناسب به‏حساب می آورد. اندازه کوچک، ترجمه زیاد و ساختار سوم آن نشان می­دهد که هر دو انتهای آمینو و کربوکسیل آن برای اتصال به مولکول‏های دیگر در دسترس هستند (21).

از چالش­های موجود در بیان پروکاریوتی پروتئین­های نوترکیب ایجاد اینکلوژن بادی در داخل سلول میزبان است که با افزودن مراحل پائین دستی در فولدینگ و اوره زدائی و سپس تخلیص نهایی علاوه بر افزایش هزینه­های تولید باعث از دست رفتن مقادیر زیادی از پروتئین طی این مراحل شده که با بیان محلول پروتئین می‏توان تا حدود زیادی از این مشکلات جلوگیری کرد. لذا با استفاده از تیوردوکسین این پروتئین را می‏توان به‏صورت محلول تولید نمود. از تیوردوکسین برای تولید پروتئین­های دیگر مانند تری پاراتید هم استفاده شده است و بیان قابل توجهی نیز داشته است (22).

تشکر و قدردانی

نویسندگان بر خود لازم می‏دانند از دانشگاه صنعتی مالک اشتر جهت انجام این پژوهش تشکر نمایند.

منابع

  1. Fuh G, Mulkerrin M, Bass S, McFarland N, et al. The human growth hormone receptor. Secretion from Escherichia coli and disulfide bonding pattern of the extracellular binding domain. Journal of Biological Chemistry. 1990; 265(6):31.
  2.  Møller N, Jørgensen JOL. Effects of growth hormone on glucose, lipid, and protein metabolism in human subjects. Endocrine reviews. 2009; 30(2): 152-77.
  3. Bidlingmaier M, Freda PU. Measurement of human growth hormone by immunoassays: current status, unsolved problems and clinical consequences. Growth Hormone & IGF Research. 2010; 20(1): 19-25.
  4. Baldi L, Hacker DL, Adam M, Wurm FM. Recombinant protein production by large-scale transient gene expression in mammalian cells: state of the art and future perspectives. Biotechnology letters. 2007; 29(5): 677-84.
  5. Doran PM. Foreign protein production in plant tissue cultures. Current Opinion in Biotechnology. 2000; 11(2): 199-204.
  6. Chu L, Robinson DK. Industrial choices for protein production by large-scale cell culture. Current Opinion in Biotechnology. 2001; 12(2): 180-7.
  7. Agrawal V, Bal M. Strategies for rapid production of therapeutic proteins in mammalian cells. Bioprocess Int. 2012; 10(4): 32-46.
  8. Panda AK. Bioprocessing of therapeutic proteins from the inclusion bodies of Escherichia coli. Biotechnology in India II: Springer; 2003.85: 43-93.
  9. Sørensen HP, Mortensen KK. Advanced genetic strategies for recombinant protein expression in Escherichia coli. Journal of biotechnology. 2005; 115(2): 113-28.
  10. Andersen DC, Krummen L. Recombinant protein expression for therapeutic applications. Current Opinion in Biotechnology. 2002; 13(2): 117-23.
  11. Filikov AV, Hayes RJ, Luo P, Stark DM, et al. Computational stabilization of human growth hormone. Protein science. 2002; 11(6): 1452-61.
  12. Dyson MR, Shadbolt SP, Vincent KJ, Perera RL, et al. Production of soluble mammalian proteins in Escherichia coli: identification of protein features that correlate with successful expression. BMC biotechnology. 2004; 4(1): 1.
  13. LaVallie ER, Lu Z, Diblasio-Smith EA, Collins-Racie LA, et al. Thioredoxin as a fusion partner for production of soluble recombinant proteins in Escherichia coli. Methods in enzymology. 2000; 326:322.
  14. Bayer M, Bayer M, Lunn C, Pigiet V. Association of thioredoxin with the inner membrane and adhesion sites in Escherichia coli. Journal of bacteriology. 1987; 169(6): 2659-66.
  15. Chen EY, Liao YC, Smith DH, Barrera-Saldaña HA,et al. The human growth hormone locus: nucleotide sequence, biology, and evolution. Genomics. 1989; 4(4):479-97.
  16. Patra AK, Mukhopadhyay R, Mukhija R, Krishnan A, et al. Optimization of inclusion body solubilization and renaturation of recombinant human growth hormone from Escherichia coli. Protein expression and purification. 2000; 18(2): 182-92.

 Ribela MTC, Gout PW, Bartolini P. Synthesis and chromatographic purification of recombinant human pituitary hormones. Journal of Chromatography B. 2003; 790(1): 285-316.

  1. Segura J, Gutiérrez-Gallego R, Ventura R, Pascual JA, et al. Growth hormone in sport: beyond Beijing 2008. Therapeutic drug monitoring. 2009; 31(1): 3-13.
  2. Saboury A, Atri M, Sanati M, Moosavi-Movahedi A, et al. Effects of calcium binding on the structure and stability of human growth hormone. International journal of biological macromolecules. 2005; 36(5): 305-9.
  3. Kelly PA. Hormones: from molecules to disease: Springer Science & Business Media, Azar 9, 1369 AP - Medical - 697 pages.
  4. Schmidt SR. Fusion protein technologies for biopharmaceuticals: applications and challenges: John Wiley & Sons; April 2013. 680 pages
  5. Hamedifar H, Salamat F, Saffarion M, Ghiasi M, et al. A novel approach for high level expression of soluble recombinant human parathyroid hormone (rhPTH 1-34) in Escherichia coli. Avicenna journal of medical biotechnology. 2017; 5(3): 193.

 

 

  1. Fuh G, Mulkerrin M, Bass S, McFarland N, et al. The human growth hormone receptor. Secretion from Escherichia coli and disulfide bonding pattern of the extracellular binding domain. Journal of Biological Chemistry. 1990; 265(6):31.
  2.  Møller N, Jørgensen JOL. Effects of growth hormone on glucose, lipid, and protein metabolism in human subjects. Endocrine reviews. 2009; 30(2): 152-77.
  3. Bidlingmaier M, Freda PU. Measurement of human growth hormone by immunoassays: current status, unsolved problems and clinical consequences. Growth Hormone & IGF Research. 2010; 20(1): 19-25.
  4. Baldi L, Hacker DL, Adam M, Wurm FM. Recombinant protein production by large-scale transient gene expression in mammalian cells: state of the art and future perspectives. Biotechnology letters. 2007; 29(5): 677-84.
  5. Doran PM. Foreign protein production in plant tissue cultures. Current Opinion in Biotechnology. 2000; 11(2): 199-204.
  6. Chu L, Robinson DK. Industrial choices for protein production by large-scale cell culture. Current Opinion in Biotechnology. 2001; 12(2): 180-7.
  7. Agrawal V, Bal M. Strategies for rapid production of therapeutic proteins in mammalian cells. Bioprocess Int. 2012; 10(4): 32-46.
  8. Panda AK. Bioprocessing of therapeutic proteins from the inclusion bodies of Escherichia coli. Biotechnology in India II: Springer; 2003.85: 43-93.
  9. Sørensen HP, Mortensen KK. Advanced genetic strategies for recombinant protein expression in Escherichia coli. Journal of biotechnology. 2005; 115(2): 113-28.
  10. Andersen DC, Krummen L. Recombinant protein expression for therapeutic applications. Current Opinion in Biotechnology. 2002; 13(2): 117-23.
  11. Filikov AV, Hayes RJ, Luo P, Stark DM, et al. Computational stabilization of human growth hormone. Protein science. 2002; 11(6): 1452-61.
  12. Dyson MR, Shadbolt SP, Vincent KJ, Perera RL, et al. Production of soluble mammalian proteins in Escherichia coli: identification of protein features that correlate with successful expression. BMC biotechnology. 2004; 4(1): 1.
  13. LaVallie ER, Lu Z, Diblasio-Smith EA, Collins-Racie LA, et al. Thioredoxin as a fusion partner for production of soluble recombinant proteins in Escherichia coli. Methods in enzymology. 2000; 326:322.
  14. Bayer M, Bayer M, Lunn C, Pigiet V. Association of thioredoxin with the inner membrane and adhesion sites in Escherichia coli. Journal of bacteriology. 1987; 169(6): 2659-66.
  15. Chen EY, Liao YC, Smith DH, Barrera-Saldaña HA,et al. The human growth hormone locus: nucleotide sequence, biology, and evolution. Genomics. 1989; 4(4):479-97.
  16. Patra AK, Mukhopadhyay R, Mukhija R, Krishnan A, et al. Optimization of inclusion body solubilization and renaturation of recombinant human growth hormone from Escherichia coli. Protein expression and purification. 2000; 18(2): 182-92.

 Ribela MTC, Gout PW, Bartolini P. Synthesis and chromatographic purification of recombinant human pituitary hormones. Journal of Chromatography B. 2003; 790(1): 285-316.

  1. Segura J, Gutiérrez-Gallego R, Ventura R, Pascual JA, et al. Growth hormone in sport: beyond Beijing 2008. Therapeutic drug monitoring. 2009; 31(1): 3-13.
  2. Saboury A, Atri M, Sanati M, Moosavi-Movahedi A, et al. Effects of calcium binding on the structure and stability of human growth hormone. International journal of biological macromolecules. 2005; 36(5): 305-9.
  3. Kelly PA. Hormones: from molecules to disease: Springer Science & Business Media, Azar 9, 1369 AP - Medical - 697 pages.
  4. Schmidt SR. Fusion protein technologies for biopharmaceuticals: applications and challenges: John Wiley & Sons; April 2013. 680 pages
  5. Hamedifar H, Salamat F, Saffarion M, Ghiasi M, et al. A novel approach for high level expression of soluble recombinant human parathyroid hormone (rhPTH 1-34) in Escherichia coli. Avicenna journal of medical biotechnology. 2017; 5(3): 193.